PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 305aa    MW: 33844.4 Da    PI: 6.3932
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016636.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-072542872154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp+++++++L +++gL+ +q+ +WF N+R +
  Aco016636.1 254 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 287
                  469*****************************87 PP

2ELK25.43.2e-09208229122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK +L++++++++ ++++E++
  Aco016636.1 208 ELKIELKQGFKSRIEDVREEIL 229
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.0E-174387IPR005540KNOX1
PfamPF037903.7E-154686IPR005540KNOX1
SMARTSM012561.2E-2298153IPR005541KNOX2
PfamPF037914.4E-17102152IPR005541KNOX2
PROSITE profilePS512139.132208228IPR005539ELK domain
PROSITE profilePS5007111.693228291IPR001356Homeobox domain
SMARTSM003892.4E-10230295IPR001356Homeobox domain
SuperFamilySSF466894.71E-16230294IPR009057Homeodomain-like
CDDcd000863.29E-11231292No hitNo description
Gene3DG3DSA:1.10.10.603.6E-25235294IPR009057Homeodomain-like
PfamPF059201.0E-17248287IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MMHGDQGMGM GLGGGVGVGI GGGGESSSMA AAAAAAAENE QLQMTKAEIA VHPLCEQLVA  60
AHIGCLRVAT PIDHLPLIDA QAAQSHSVLQ SYAARHRPFL PPHEKHELDS FLAQYLLALC  120
SFREQLQQHV RVHAVEAVMA CREIEQSLHD LTGATLEEGS GATMSDDEDE LQMDGALDIS  180
MDGHDMMGFG PLLPTDSERS LMERVRQELK IELKQGFKSR IEDVREEILR KRRAGKLPGD  240
TTTILKQWWQ QHSKWPYPTE DDKAKLVEET GLQLKQINNW FINQRKRNWH NNSQSTSLKS  300
KRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284303RKRNWHNNSQSTSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389824.11e-179PREDICTED: homeobox protein knotted-1-like 3 isoform X2
RefseqXP_009389816.11e-179PREDICTED: homeobox protein knotted-1-like 3 isoform X1
SwissprotQ94LW31e-174KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLM0RWS41e-179M0RWS4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03660_0011e-179(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-152KNOTTED-like homeobox of Arabidopsis thaliana 7